PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009613368.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 290aa    MW: 31193.7 Da    PI: 8.9951
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009613368.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding38.72.4e-121156447
                     S-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  4 WTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqky 47
                     W+ e d+ + +a + ++ +   +W++Ia+ ++ g+tlk++k++++ +
   XP_009613368.1 11 WSREQDKAFENALATYPEDspdRWEKIASDVP-GKTLKEVKHHYNLL 56
                     ********************************.***********977 PP

2Myb_DNA-binding422.1e-13118162347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT++E+ l++ +  ++G+g+W++I+r +  +Rt+ q+ s+ qky
   XP_009613368.1 118 AWTEDEHRLFLLGLDKYGKGDWRSISRNFVVTRTPTQVASHAQKY 162
                      6*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512938.177659IPR017884SANT domain
SMARTSM007175.3E-11759IPR001005SANT/Myb domain
SuperFamilySSF466894.97E-13965IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.5E-71058IPR009057Homeodomain-like
PfamPF002491.2E-91156IPR001005SANT/Myb domain
CDDcd001671.70E-101157No hitNo description
PROSITE profilePS5129417.581110167IPR017930Myb domain
SuperFamilySSF466891.27E-16113168IPR009057Homeodomain-like
TIGRFAMsTIGR015572.5E-17115165IPR006447Myb domain, plants
SMARTSM007173.2E-10115165IPR001005SANT/Myb domain
PfamPF002492.6E-11118162IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-10118161IPR009057Homeodomain-like
CDDcd001677.98E-10118163No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 290 aa     Download sequence    Send to blast
MTIDESSSSI WSREQDKAFE NALATYPEDS PDRWEKIASD VPGKTLKEVK HHYNLLLDDV  60
SRIESGCVPL PCYNSSSDSS TSHGADEGIG KKSGNSNGES NHGGKSTRAD QERRKGIAWT  120
EDEHRLFLLG LDKYGKGDWR SISRNFVVTR TPTQVASHAQ KYFIRLNSMN RDRRRSSIHD  180
ITSVNTGEVS VPQGPITGQS NGSATGSSSK QSKQPTPALA APPGVGIYGA TSIGQPIGGP  240
FVSAVGTPVN LPPSTHMAYG VRPPLPGAVV PGAPMNMGPM TYPMPHTMHR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A1e-1811761176RADIALIS
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00500DAPTransfer from AT5G08520Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009613368.10.0PREDICTED: transcription factor DIVARICATA
SwissprotQ8S9H73e-67DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A068VFI41e-172A0A068VFI4_COFCA; Uncharacterized protein
STRINGGLYMA07G28310.11e-164(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA41492445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08520.11e-107MYB family protein